PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang08g01110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 275aa    MW: 31068.7 Da    PI: 9.6572
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang08g01110.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.81.2e-1362106147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
   Vang08g01110.1  62 RESWTEQEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 106
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.48E-1756112IPR009057Homeodomain-like
PROSITE profilePS5129415.40857111IPR017930Myb domain
TIGRFAMsTIGR015571.1E-1860109IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.5E-760112IPR009057Homeodomain-like
SMARTSM007175.3E-1161109IPR001005SANT/Myb domain
PfamPF002492.1E-1162106IPR001005SANT/Myb domain
CDDcd001671.30E-864107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
LMVSVNPNPA QGFYFFDPSN MTLPGVNSLP PPPPPTQTPA LSPAVEDPNK KIRKPYTITK  60
SRESWTEQEH DKFLEALQLF DRDWKKIEAF VGSKTVIQIR SHAQKYFLKV QKNGTSEHVP  120
PPRPKRKATH PYPQKAPKIN DMGLTGVAQT IPLNCCYSSS NENTHPIWPS SKKMNQGSQG  180
KPMKVMPDFA QVYSFIGSVF DPNSTNQLQK LRQMDPINVE TVLLLMRNLS VNLMSPEFED  240
HDNESPVRSL LEALLYSLSV FRVMLRSFEL AFNI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150421e-128AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003548642.11e-122PREDICTED: protein REVEILLE 5 isoform X1
SwissprotQ6R0H05e-97RVE3_ARATH; Protein REVEILLE 3
TrEMBLI1MKS31e-122I1MKS3_SOYBN; Uncharacterized protein
STRINGGLYMA16G03640.11e-121(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01520.12e-95MYB_related family protein